Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT6 Peptide - middle region

NUDT6 Peptide - middle region

Product Specifications

Product Name Alternative

ASFGF2, FGF-2, FGF-AS, FGF2AS, bFGF, gfg, gfg-1, GFG1, GFG-1

UniProt

P53370

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUDT6 Rabbit Polyclonal Antibody (orb585206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009014

Preservative

Lyophilized powder

AA Sequence

ASLGFCFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRG (NM_000412) Human Recombinant Protein
TP310166L 1 mg

HRG (NM_000412) Human Recombinant Protein

Sign In for Pricing
View Details
CAPRIN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV634196 1.0 µg DNA

CAPRIN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep
VK580011-01 50 µg

Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep

Sign In for Pricing
View Details
Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep
VK580011-02 100 µg

Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep

Sign In for Pricing
View Details
Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep
VK580011-03 1 mg

Recombinant CDV H/Hemagglutinin glycoprotein Protein, C-strep

Sign In for Pricing
View Details
IGFBP-I Antibody
OAMA01215-1MG 1 mg

IGFBP-I Antibody

Sign In for Pricing
View Details