Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP6 Peptide - N-terminal region

PARP6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC131971, pART17

UniProt

Q2NL67

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP6 Rabbit Polyclonal Antibody (orb574822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064599

Preservative

Lyophilized powder

AA Sequence

MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myelodysplastic Syndrome Bone Marrow Mononuclear Cells (Relapsed/Refractory)
ABC-TC3959 1 Vial

Human Myelodysplastic Syndrome Bone Marrow Mononuclear Cells (Relapsed/Refractory)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Elongation factor G (fusA), partial
MBS1294166 Inquire

Recombinant Bacillus cereus Elongation factor G (fusA), partial

Sign In for Pricing
View Details
anti-PKCθ (Phospho-Ser695)
LF-PA20404 100 ul

anti-PKCθ (Phospho-Ser695)

Sign In for Pricing
View Details
PLK1 Peptide (AAP46120)
AAP46120-100UG 100 µg

PLK1 Peptide (AAP46120)

Sign In for Pricing
View Details
GFOD1 (NM_018988) Human Tagged ORF Clone Lentiviral Particle
RC215584L3V 200 µL

GFOD1 (NM_018988) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD33 Polyclonal Antibody
MBS2527205-01 0.02 mL

CD33 Polyclonal Antibody

Sign In for Pricing
View Details