Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP6 Peptide - N-terminal region

PARP6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC131971, pART17

UniProt

Q2NL67

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP6 Rabbit Polyclonal Antibody (orb574822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064599

Preservative

Lyophilized powder

AA Sequence

MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppia Rat siRNA Oligo Duplex (Locus ID 25518)
SR500868 1 Kit

Ppia Rat siRNA Oligo Duplex (Locus ID 25518)

Sign In for Pricing
View Details
UHRF1 Polyclonal Antibody
E20-75066 100 µg

UHRF1 Polyclonal Antibody

Sign In for Pricing
View Details
Mcm5 (NM_008566) Mouse Tagged ORF Clone Lentiviral Particle
MR210350L3V 200 µL

Mcm5 (NM_008566) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ALKBH1 Rabbit Monoclonal Antibody
E56G3159 100 µL

ALKBH1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse HIPK1 (KIAA0630), Rabbit Polyclonal
MKA0630PA Inquire

Anti-Mouse HIPK1 (KIAA0630), Rabbit Polyclonal

Sign In for Pricing
View Details
KATNA1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9308R-BF350-TR 20 µL

KATNA1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details