Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLK2 Peptide - middle region

PLK2 Peptide - middle region

Product Specifications

Product Name Alternative

SNK, hSNK, hPlk2

UniProt

Q9NYY3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLK2 Rabbit Polyclonal Antibody (orb581615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006613

Preservative

Lyophilized powder

AA Sequence

SDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF9 Protein Vector (Human) (pPB-C-His)
PV005865 500 ng

C1QTNF9 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
TSTD1 protein (His tag)
80R-1708 0.05 mg

TSTD1 protein (His tag)

Sign In for Pricing
View Details
B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody
MBS2032501-01 0.1 mL

B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody

Sign In for Pricing
View Details
B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody
MBS2032501-02 0.2 mL

B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody

Sign In for Pricing
View Details
B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody
MBS2032501-03 0.5 mL

B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody

Sign In for Pricing
View Details
B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody
MBS2032501-04 1 mL

B-Cell CLL/Lymphoma 10 (Bcl10) Polyclonal Antibody

Sign In for Pricing
View Details