RP11-298P3.3 Peptide - N-terminal region
RP11-298P3.3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
92M18.3, CG005, FLJ36195, FLJ41089, FLJ43077, PFAAP5, RP11-298P3.3
UniProt
Q92802
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RP11-298P3.3 Rabbit Polyclonal Antibody (orb325988) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149102
Preservative
Lyophilized powder
AA Sequence
EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680096-100 1x 100 µL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470158-100 1x 100 µL
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402423-500 1x 500 µL
BOB.1 (B-Cell Marker) (BOB1/2423), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details