SERPINA1 Peptide - C-terminal region
SERPINA1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
A1A, A1AT, AAT, MGC23330, MGC9222, PI, PI1, PRO2275, alpha1AT
UniProt
P01009
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SERPINA1 Rabbit Polyclonal Antibody (orb584269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001121178
Preservative
Lyophilized powder
AA Sequence
LTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP52043PU-N 400 µL
HIAT1 (MFSD14A) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![IL3RB (CSF2RB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]](https://cdn.genprice.uk/products/937/6868c3d8994c49e6dc4007a0/imageurl/ta807875am.webp)
TA807875AM 100 µL
IL3RB (CSF2RB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G5]
Sign In for Pricing
View Details ![PRKRA Rabbit Monoclonal Antibody [Clone ID: 23GB2340]](https://cdn.genprice.uk/products/937/6868c301994c49e6dc3ed0a7/imageurl/ta425138.webp)
TA425138 100 µL
PRKRA Rabbit Monoclonal Antibody [Clone ID: 23GB2340]
Sign In for Pricing
View Details 