Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA1 Peptide - C-terminal region

SERPINA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

A1A, A1AT, AAT, MGC23330, MGC9222, PI, PI1, PRO2275, alpha1AT

UniProt

P01009

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINA1 Rabbit Polyclonal Antibody (orb584269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121178

Preservative

Lyophilized powder

AA Sequence

LTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK3 Rabbit Polyclonal Antibody
AP21122PU-N 100 µg

PAK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 23 (CLDN23) Human Gene Knockout Kit (CRISPR)
KN421232 1 Kit

Claudin 23 (CLDN23) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL
BNC041239-100 1x 100 µL

Napsin-A (NAPSA/1239), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF488A conjugate, 0.1mg/mL
BNC882593-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS629447 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
HSD11B1 (NM_181755) Human Recombinant Protein
TP312093L 1 mg

HSD11B1 (NM_181755) Human Recombinant Protein

Sign In for Pricing
View Details