Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim11 Peptide - C-terminal region

Trim11 Peptide - C-terminal region

Product Specifications

UniProt

Q99PQ2

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim11 Rabbit Polyclonal Antibody (orb330297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444398

Preservative

Lyophilized powder

AA Sequence

GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LZTS1 Adenovirus (Mouse)
27871054 1.0 mL

LZTS1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse PRR16 siRNA
abx929954-01 15 nmol

Mouse PRR16 siRNA

Sign In for Pricing
View Details
Mouse PRR16 siRNA
abx929954-02 30 nmol

Mouse PRR16 siRNA

Sign In for Pricing
View Details
Colibactin
MBS5816423 Inquire

Colibactin

Sign In for Pricing
View Details
Olr1330 AAV Vector (Rat) (CMV)
33846106 1 µg

Olr1330 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant Rickettsia typhi UvrABC system protein C (uvrC), partial
MBS1373262 Inquire

Recombinant Rickettsia typhi UvrABC system protein C (uvrC), partial

Sign In for Pricing
View Details