Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trim11 Peptide - C-terminal region

Trim11 Peptide - C-terminal region

Product Specifications

UniProt

Q99PQ2

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Trim11 Rabbit Polyclonal Antibody (orb330297) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444398

Preservative

Lyophilized powder

AA Sequence

GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] GALT Rabbit pAb (APR29481N)
APR29481N-01 50 µL

[KO Validated] GALT Rabbit pAb (APR29481N)

Sign In for Pricing
View Details
[KO Validated] GALT Rabbit pAb (APR29481N)
APR29481N-02 100 µL

[KO Validated] GALT Rabbit pAb (APR29481N)

Sign In for Pricing
View Details
[KO Validated] GALT Rabbit pAb (APR29481N)
APR29481N-03 200 µL

[KO Validated] GALT Rabbit pAb (APR29481N)

Sign In for Pricing
View Details
Phospho-CDKN1B (Thr157) Rabbit Polyclonal Antibody (BF555)
orb1584303 100 µL

Phospho-CDKN1B (Thr157) Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
SIP1 Peptide - middle region
orb2017753 100 µg

SIP1 Peptide - middle region

Sign In for Pricing
View Details
OR5B19P AAV Vector (Human) (CMV)
35401101 1 µg

OR5B19P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details