Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP10 Peptide - middle region

USP10 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0190, MGC2621, UBPO

UniProt

Q14694

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005144

Preservative

Lyophilized powder

AA Sequence

GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF41 Antibody
orb1313684-01 30 µL

RNF41 Antibody

Sign In for Pricing
View Details
RNF41 Antibody
orb1313684-02 50 μL

RNF41 Antibody

Sign In for Pricing
View Details
RNF41 Antibody
orb1313684-03 100 µL

RNF41 Antibody

Sign In for Pricing
View Details
TMPRSS6 Rabbit Polyclonal Antibody
orb2987641-01 30 µL

TMPRSS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS6 Rabbit Polyclonal Antibody
orb2987641-02 50 µL

TMPRSS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS6 Rabbit Polyclonal Antibody
orb2987641-03 100 µL

TMPRSS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details