Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF816A Peptide - N-terminal region

ZNF816A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC125619, ZNF816A

UniProt

Q0VGE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF816A Rabbit Polyclonal Antibody (orb581080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026835

Preservative

Lyophilized powder

AA Sequence

MEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDIHHFEFQWQEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT4/CARM1 (C31G9) Rabbit Monoclonal Antibody
CST 3379T 20 µL

PRMT4/CARM1 (C31G9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bovine Matrilin-1 (MATN1) ELISA Kit
NSL1348Bo 96 Tests

Bovine Matrilin-1 (MATN1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Mucolipin-1 (MCOLN1)
MBS7020012-01 0.02 mg

Recombinant Macaca fascicularis Mucolipin-1 (MCOLN1)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Mucolipin-1 (MCOLN1)
MBS7020012-02 0.1 mg

Recombinant Macaca fascicularis Mucolipin-1 (MCOLN1)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis Mucolipin-1 (MCOLN1)
MBS7020012-03 5x 0.1 mg

Recombinant Macaca fascicularis Mucolipin-1 (MCOLN1)

Sign In for Pricing
View Details
Mouse Monoclonal CLOCK Antibody (OTI2H7) [Alexa Fluor 405]
NBP2-71479AF405 0.1 mL

Mouse Monoclonal CLOCK Antibody (OTI2H7) [Alexa Fluor 405]

Sign In for Pricing
View Details