Dnalc4 Peptide - middle region
Dnalc4 Peptide - middle region
Product Specifications
Product Name Alternative
D15Ertd424e, Dnal4, Dnalc4
UniProt
Q9DCM4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dnalc4 Rabbit Polyclonal Antibody (orb325718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_059498
Preservative
Lyophilized powder
AA Sequence
ESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
249643-ML405 100 µL
OSR1 (Odd-skipped Related 1 (Drosophila), ODD) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
GTR15172191 1 Vial
Lentiviral mouse Nkx6-2 shRNA (UAS) - Lentiviral mouse Nkx6-2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details GTR15295487 1 Vial
Lentiviral mouse Bspry shRNA (UAS) - Lentiviral mouseBspry shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details