Dnalc4 Peptide - middle region
Dnalc4 Peptide - middle region
Product Specifications
Product Name Alternative
D15Ertd424e, Dnal4, Dnalc4
UniProt
Q9DCM4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dnalc4 Rabbit Polyclonal Antibody (orb325718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_059498
Preservative
Lyophilized powder
AA Sequence
ESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
253777-AP 100 µL
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (AP) discontinued
Sign In for Pricing
View Details 
MBS6383660-01 0.1 mL
KLF15 (Krueppel-like Factor 15, Kidney-enriched Krueppel-like Factor, KKLF, DKFZp779M1320) (MaxLight 650)
Sign In for Pricing
View Details MBS6383660-02 5x 0.1 mL
KLF15 (Krueppel-like Factor 15, Kidney-enriched Krueppel-like Factor, KKLF, DKFZp779M1320) (MaxLight 650)
Sign In for Pricing
View Details