Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mtm1 Peptide - N-terminal region

Mtm1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AF073996, KIAA4176, Mtm, mKIAA4176

UniProt

B1AW21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mtm1 Rabbit Polyclonal Antibody (orb330823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157664

Preservative

Lyophilized powder

AA Sequence

SASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF594 conjugate, 0.1mg/mL
BNC942278-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2278R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIP5K Antibody
8C11935-AAT 50 µg

PIP5K Antibody

Sign In for Pricing
View Details
ANKRD13D (NM_207354) Human Over-expression Lysate
LC403977 20 µg

ANKRD13D (NM_207354) Human Over-expression Lysate

Sign In for Pricing
View Details
Eef2k Mouse Gene Knockout Kit (CRISPR)
KN305017RB 1 Kit

Eef2k Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human EXOC2 activation kit by CRISPRa
GA110955 1 Kit

Human EXOC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tmem218 (NM_025464) Mouse Tagged ORF Clone
MG200476 10 µg

Tmem218 (NM_025464) Mouse Tagged ORF Clone

Sign In for Pricing
View Details