Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mtm1 Peptide - N-terminal region

Mtm1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AF073996, KIAA4176, Mtm, mKIAA4176

UniProt

B1AW21

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mtm1 Rabbit Polyclonal Antibody (orb330823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157664

Preservative

Lyophilized powder

AA Sequence

SASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BASP1 activation kit by CRISPRa
GA107095 1 Kit

Human BASP1 activation kit by CRISPRa

Sign In for Pricing
View Details
TTC28 Human Gene Knockout Kit (CRISPR)
KN426945 1 Kit

TTC28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTMR14 (NM_001077526) Human Over-expression Lysate
LC421458 20 µg

MTMR14 (NM_001077526) Human Over-expression Lysate

Sign In for Pricing
View Details
EASYStep Pro Human Cortisol (Cor) ELISA Kit
RDEp-Cor-Hu 96 Tests

EASYStep Pro Human Cortisol (Cor) ELISA Kit

Sign In for Pricing
View Details
Human C15orf61 activation kit by CRISPRa
GA115536 1 Kit

Human C15orf61 activation kit by CRISPRa

Sign In for Pricing
View Details
OR51S1 Human Gene Knockout Kit (CRISPR)
KN415968 1 Kit

OR51S1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details