Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROKR2 Peptide - C-terminal region

PROKR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR73L1, GPR73b, GPRg2, KAL3, PKR2, dJ680N4.3

UniProt

Q8NFJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROKR2 Rabbit Polyclonal Antibody (orb331260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_658986

Preservative

Lyophilized powder

AA Sequence

CFVTVKNNTMKYFKKMMLLHWRPSQRGSKSSADLDLRTNGVPTTEEVDCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB7 (RAB7A) Rabbit Monoclonal Antibody [Clone ID: R07-8G1]
TA385109 100 µL

RAB7 (RAB7A) Rabbit Monoclonal Antibody [Clone ID: R07-8G1]

Sign In for Pricing
View Details
Spinetoram L
TRC-S683613-5MG 5 mg

Spinetoram L

Sign In for Pricing
View Details
GPRC5C (NM_022036) Human Over-expression Lysate
LC402899 20 µg

GPRC5C (NM_022036) Human Over-expression Lysate

Sign In for Pricing
View Details
AK3L1 (AK4) Rabbit Polyclonal Antibody
TA371795 100 µL

AK3L1 (AK4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBXD5 (UBXN11) (NM_001077262) Human Over-expression Lysate
LY421394 100 µg

UBXD5 (UBXN11) (NM_001077262) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD54 Antibody[YN1/1.7.4]
E-AB-F1018H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD54 Antibody[YN1/1.7.4]

Sign In for Pricing
View Details