Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROKR2 Peptide - C-terminal region

PROKR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR73L1, GPR73b, GPRg2, KAL3, PKR2, dJ680N4.3

UniProt

Q8NFJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROKR2 Rabbit Polyclonal Antibody (orb331260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_658986

Preservative

Lyophilized powder

AA Sequence

CFVTVKNNTMKYFKKMMLLHWRPSQRGSKSSADLDLRTNGVPTTEEVDCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL4 Human Gene Knockout Kit (CRISPR)
KN401685 1 Kit

TCEAL4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Epiandrosterone-d5
TRC-E578002-1MG 1 mg

Epiandrosterone-d5

Sign In for Pricing
View Details
Human CCDC66 activation kit by CRISPRa
GA117212 1 Kit

Human CCDC66 activation kit by CRISPRa

Sign In for Pricing
View Details
Block, for Microtube Strips (2.0ml) 6 strips
BSW2MTS 1 Each

Block, for Microtube Strips (2.0ml) 6 strips

Sign In for Pricing
View Details
PIGU Rabbit Polyclonal Antibody
TA379921 100 µL

PIGU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMDHD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]
TA809954BM 100 µL

AMDHD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details