Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLN2 Peptide - C-terminal region

RLN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H2, RLXH2, bA12D24.1.1, bA12D24.1.2

UniProt

P04090

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RLN2 Rabbit Polyclonal Antibody (orb326489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_604390

Preservative

Lyophilized powder

AA Sequence

PQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r72 Mouse Gene Knockout Kit (CRISPR)
KN519203 1 Kit

Vmn2r72 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2'-OMe-ibu-G Phosphoramidite
TRC-K591800-2.5G 2.5 g

2'-OMe-ibu-G Phosphoramidite

Sign In for Pricing
View Details
tert-Butyl 6'-Bromo-1',2'-dihydrospiro[azetidine-3,3'-indole]-1-carboxylate
TRC-B448590-250MG 250 mg

tert-Butyl 6'-Bromo-1',2'-dihydrospiro[azetidine-3,3'-indole]-1-carboxylate

Sign In for Pricing
View Details
Recombinant Human Afamin/AFM (C-6His)
PKSH033942-01 10 µg

Recombinant Human Afamin/AFM (C-6His)

Sign In for Pricing
View Details
Recombinant Human Afamin/AFM (C-6His)
PKSH033942-02 50 µg

Recombinant Human Afamin/AFM (C-6His)

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800135 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details