Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLN2 Peptide - C-terminal region

RLN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H2, RLXH2, bA12D24.1.1, bA12D24.1.2

UniProt

P04090

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RLN2 Rabbit Polyclonal Antibody (orb326489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_604390

Preservative

Lyophilized powder

AA Sequence

PQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBWD1 (NM_001145356) Human Over-expression Lysate
LC428841 20 µg

CBWD1 (NM_001145356) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome b5 Polyclonal Antibody
E-AB-11133-01 20 µL

Cytochrome b5 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome b5 Polyclonal Antibody
E-AB-11133-02 60 µL

Cytochrome b5 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome b5 Polyclonal Antibody
E-AB-11133-03 120 µL

Cytochrome b5 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome b5 Polyclonal Antibody
E-AB-11133-04 200 µL

Cytochrome b5 Polyclonal Antibody

Sign In for Pricing
View Details
TRPV6 antibody
FNab09030 100 µg

TRPV6 antibody

Sign In for Pricing
View Details