Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPM6A Peptide - C-terminal region

GPM6A Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPM6, M6A

UniProt

P51674

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPM6A Rabbit Polyclonal Antibody (orb586134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_005268

Preservative

Lyophilized powder

AA Sequence

IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CCL4/ MIP1B Protein, Untagged, E.coli-100ug
QP10293-ec-100ug 100ug

Recombinant Rat CCL4/ MIP1B Protein, Untagged, E.coli-100ug

Sign In for Pricing
View Details
PLV3-CMV-ULK1 (human) -Myc-CopGFP-Puro
BZ50567 1 Vial

PLV3-CMV-ULK1 (human) -Myc-CopGFP-Puro

Sign In for Pricing
View Details
TRIM7 Mouse Monoclonal Antibody
AMM83256-01 1 Each

TRIM7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TRIM7 Mouse Monoclonal Antibody
AMM83256-02 50 µL

TRIM7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TRIM7 Mouse Monoclonal Antibody
AMM83256-03 100 µL

TRIM7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CCNJL (NM_024565) Human Over-expression Lysate
LC411233 20 µg

CCNJL (NM_024565) Human Over-expression Lysate

Sign In for Pricing
View Details