Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRN Peptide - N-terminal region

SPRN Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ41197, SHADOO, SHO, bA108K14.1

UniProt

Q5BIV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRN Rabbit Polyclonal Antibody (orb586094) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012526

Preservative

Lyophilized powder

AA Sequence

LLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac Salsolinol Hydrochloride
TRC-S100000-5G 5 g

rac Salsolinol Hydrochloride

Sign In for Pricing
View Details
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), Biotin conjugate, 0.1mg/mL
BNCB3076-100 1x 100 µL

APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
n-Myc (MYCN) Human Gene Knockout Kit (CRISPR)
KN401241 1 Kit

n-Myc (MYCN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Small intestine
CR562188 5 µg

Tissue Total RNA, Small intestine

Sign In for Pricing
View Details
Steviol Acyl Glucuronide Potassium Salt
TRC-S686728-5MG 5 mg

Steviol Acyl Glucuronide Potassium Salt

Sign In for Pricing
View Details
1-[(2R)-N’-Boc-2-amino-2-cyclohexylacetyl]-N-(4’-cyanobenzyl)-2-L-azetidinecarboxamide
TRC-B617670-5MG 5 mg

1-[(2R)-N’-Boc-2-amino-2-cyclohexylacetyl]-N-(4’-cyanobenzyl)-2-L-azetidinecarboxamide

Sign In for Pricing
View Details