Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTX3 Peptide - N-terminal region

MTX3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686O1788

UniProt

E9PB57

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTX3 Rabbit Polyclonal Antibody (orb586389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001161213

Preservative

Lyophilized powder

AA Sequence

VSQPAKILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ESM1 Protein
E30P11399 20 µg

Recombinant Human ESM1 Protein

Sign In for Pricing
View Details
Vmn2r62 Mouse Gene Knockout Kit (CRISPR)
KN519193 1 Kit

Vmn2r62 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIK3C2B ORF Vector (Human) (pORF)
36677011 1.0 µg DNA

PIK3C2B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal beta I Tubulin Antibody (OTI4A3) [Alexa Fluor 647]
NBP2-72225AF647 0.1 mL

Mouse Monoclonal beta I Tubulin Antibody (OTI4A3) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human TSEN34 Protein - (Dry Ice)
H00079042-P01-2ug 2 µg

Recombinant Human TSEN34 Protein - (Dry Ice)

Sign In for Pricing
View Details
Tributylethynylstannane
290772-01 1 g

Tributylethynylstannane

Sign In for Pricing
View Details