Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA4 Peptide - C-terminal region

IFNA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

INFA4, MGC142200

UniProt

P05014

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNA4 Rabbit Polyclonal Antibody (orb584775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066546

Preservative

Lyophilized powder

AA Sequence

ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: B-A38]
AM03022AF-N 200 µg

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: B-A38]

Sign In for Pricing
View Details
Nicotine Lactate
TRC-N262180-2.5G 2.5 g

Nicotine Lactate

Sign In for Pricing
View Details
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
AP06504PU-N 100 µg

Caspase 3 (CASP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human REG4 activation kit by CRISPRa
GA113334 1 Kit

Human REG4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D5]
TA506383BM 100 µL

CD163 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D5]

Sign In for Pricing
View Details
Cyanine 5 hydrazide [equivalent to Cy5® hydrazide]
156-AAT 1 mg

Cyanine 5 hydrazide [equivalent to Cy5® hydrazide]

Sign In for Pricing
View Details