Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA4 Peptide - C-terminal region

IFNA4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

INFA4, MGC142200

UniProt

P05014

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNA4 Rabbit Polyclonal Antibody (orb584775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066546

Preservative

Lyophilized powder

AA Sequence

ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNase II (DNASE2) (NM_001375) Human Over-expression Lysate
LC419982 20 µg

DNase II (DNASE2) (NM_001375) Human Over-expression Lysate

Sign In for Pricing
View Details
Human H2AW activation kit by CRISPRa
GA114244 1 Kit

Human H2AW activation kit by CRISPRa

Sign In for Pricing
View Details
ADAMTS9 Human Gene Knockout Kit (CRISPR)
KN417581 1 Kit

ADAMTS9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
hnRNP C1+C2 Recombinant Rabbit Monoclonal Antibody [SN0652]
ET1611-2 100 µL

hnRNP C1+C2 Recombinant Rabbit Monoclonal Antibody [SN0652]

Sign In for Pricing
View Details
5-Phenylhydantoin
TRC-P335000-500MG 500 mg

5-Phenylhydantoin

Sign In for Pricing
View Details
Dxd Rabbit Monoclonal Antibody [Clone ID: 1A12]
TA421202 100 µg

Dxd Rabbit Monoclonal Antibody [Clone ID: 1A12]

Sign In for Pricing
View Details