Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMX2 Peptide - N-terminal region

EMX2 Peptide - N-terminal region

Product Specifications

UniProt

Q04743

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMX2 Rabbit Polyclonal Antibody (orb573877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004089

Preservative

Lyophilized powder

AA Sequence

ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ctu2 Antibody
orb853889 2 mg

Ctu2 Antibody

Sign In for Pricing
View Details
RAB28, ID (RAB28, Ras-related protein Rab-28)
040756 200 µL

RAB28, ID (RAB28, Ras-related protein Rab-28)

Sign In for Pricing
View Details
Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit
MBS9321032-01 48 Well

Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit
MBS9321032-02 96 Well

Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit
MBS9321032-03 5x 96 Well

Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit

Sign In for Pricing
View Details
Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit
MBS9321032-04 10x 96 Well

Human Putative uncharacterized protein C1orf126, C1orf126 ELISA Kit

Sign In for Pricing
View Details