Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMX2 Peptide - N-terminal region

EMX2 Peptide - N-terminal region

Product Specifications

UniProt

Q04743

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMX2 Rabbit Polyclonal Antibody (orb573877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_004089

Preservative

Lyophilized powder

AA Sequence

ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Tuberculosis rplU Protein (aa 1-103)
VAng-Yyj0604-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis rplU Protein (aa 1-103)

Sign In for Pricing
View Details
SCUBE2 Rabbit Polyclonal Antibody
TA319990 100 µg

SCUBE2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RORA antibody - N-terminal region (ARP45642_P050)
ARP45642_P050 100 µL

RORA antibody - N-terminal region (ARP45642_P050)

Sign In for Pricing
View Details
CUX1 Polyclonal Antibody
MBS9402546-01 0.05 mL

CUX1 Polyclonal Antibody

Sign In for Pricing
View Details
CUX1 Polyclonal Antibody
MBS9402546-02 0.1 mL

CUX1 Polyclonal Antibody

Sign In for Pricing
View Details
CUX1 Polyclonal Antibody
MBS9402546-03 5x 0.1 mL

CUX1 Polyclonal Antibody

Sign In for Pricing
View Details