Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DACT3 Peptide - C-terminal region

DACT3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC15476, RRR1

UniProt

Q96B18

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DACT3 Rabbit Polyclonal Antibody (orb586600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659493

Preservative

Lyophilized powder

AA Sequence

AAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYPTAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-P (C-Peptide) BioAssayTM ELISA Kit (Rat) discontinued
354348-01 48 Tests

C-P (C-Peptide) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
C-P (C-Peptide) BioAssayTM ELISA Kit (Rat) discontinued
354348-02 96 Tests

C-P (C-Peptide) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Mouse Ifngr2 Pre-designed siRNA Set A
SI106523A 1 Each

Mouse Ifngr2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
BD4 (DEFB104A) Human shRNA Plasmid Kit (Locus ID 140596)
TL319810 1 Kit

BD4 (DEFB104A) Human shRNA Plasmid Kit (Locus ID 140596)

Sign In for Pricing
View Details
AdmiRa-Off-mmu-miR-8097 Virus
mm6911 1.0 mL

AdmiRa-Off-mmu-miR-8097 Virus

Sign In for Pricing
View Details
Mouse diamine oxidase, DAO ELISA Kit
CSB-E10090m-01 48 Tests

Mouse diamine oxidase, DAO ELISA Kit

Sign In for Pricing
View Details