Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3D19 Peptide - C-terminal region

SH3D19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EBP, EVE1, Kryn, MGC105136, MGC118910, MGC118911, MGC118912, MGC118913, SH3P19

UniProt

C9JDW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3D19 Rabbit Polyclonal Antibody (orb586743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001009555

Preservative

Lyophilized powder

AA Sequence

RGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNJ9 Human Gene Knockout Kit (CRISPR)
KN416336 1 Kit

KCNJ9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UTP14A Antibody
8C11624-AAT 50 µg

UTP14A Antibody

Sign In for Pricing
View Details
1-Pentyne
TRC-P284800-1G 1 g

1-Pentyne

Sign In for Pricing
View Details
Mini Sample Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-MSEL-M0050-01 24 Tests

Mini Sample Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-MSEL-M0050-02 48 Tests

Mini Sample Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit
E-MSEL-M0050-03 96 Tests

Mini Sample Mouse SDF-1/CXCL12 (Stromal Cell Derived Factor 1) ELISA Kit

Sign In for Pricing
View Details