SH3D19 Peptide - C-terminal region
SH3D19 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EBP, EVE1, Kryn, MGC105136, MGC118910, MGC118911, MGC118912, MGC118913, SH3P19
UniProt
C9JDW6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH3D19 Rabbit Polyclonal Antibody (orb586743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001009555
Preservative
Lyophilized powder
AA Sequence
RGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472289-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY431302 100 µg
STEAP1B (NM_001164460) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNUB2054-100 1x 100 µL
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), 0.2mg/mL
Sign In for Pricing
View Details 
BNC680812-100 1x 100 µL
Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details