Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CORO1B Peptide - C-terminal region

CORO1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CORONIN-2, DKFZp762I166

UniProt

Q9BR76

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CORO1B Rabbit Polyclonal Antibody (orb586786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065174

Preservative

Lyophilized powder

AA Sequence

STTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCGF6   monoclonal antibody
MB11378 50ul

PCGF6 monoclonal antibody

Sign In for Pricing
View Details
LAMP1 Rabbit pAb (APR24865N)
APR24865N-01 50 µL

LAMP1 Rabbit pAb (APR24865N)

Sign In for Pricing
View Details
LAMP1 Rabbit pAb (APR24865N)
APR24865N-02 100 µL

LAMP1 Rabbit pAb (APR24865N)

Sign In for Pricing
View Details
LAMP1 Rabbit pAb (APR24865N)
APR24865N-03 200 µL

LAMP1 Rabbit pAb (APR24865N)

Sign In for Pricing
View Details
pCMV-VPS11-3×Myc-Neo Plasmid
PVT50282 2 µg

pCMV-VPS11-3×Myc-Neo Plasmid

Sign In for Pricing
View Details
Claudin 5 (CLDN5) (AP) discontinued
C5838-47A-AP 100 µL

Claudin 5 (CLDN5) (AP) discontinued

Sign In for Pricing
View Details