Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CORO1B Peptide - C-terminal region

CORO1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

CORONIN-2, DKFZp762I166

UniProt

Q9BR76

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CORO1B Rabbit Polyclonal Antibody (orb586786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065174

Preservative

Lyophilized powder

AA Sequence

STTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD1 Rabbit Polyclonal Antibody (APC-Cy5)
orb1579392 100 µL

DRD1 Rabbit Polyclonal Antibody (APC-Cy5)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)
MBS1305360-01 0.02 mg (E-Coli)

Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)
MBS1305360-02 0.1 mg (E-Coli)

Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)
MBS1305360-03 0.02 mg (Yeast)

Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)
MBS1305360-04 0.1 mg (Yeast)

Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)
MBS1305360-05 0.02 mg (Baculovirus)

Recombinant Human Ankyrin repeat domain-containing protein 37 (ANKRD37)

Sign In for Pricing
View Details