Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YTHDF2 Peptide - C-terminal region

YTHDF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HGRG8, NY-REN-2

UniProt

Q9Y5A9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YTHDF2 Rabbit Polyclonal Antibody (orb586914) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057342

Preservative

Lyophilized powder

AA Sequence

QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLS-573151
C4738-10 10 mg

MLS-573151

Sign In for Pricing
View Details
SERTAD1 Protein Vector (Rat) (pPM-C-HA)
43509026 500 ng

SERTAD1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RavA Antibody
orb825373 2 mg

RavA Antibody

Sign In for Pricing
View Details
Human Mammary carcinoma Marker/Carbohydrate antigen15 3 ELISA Kit
MBS723359-01 48 Strip Well (Competitive)

Human Mammary carcinoma Marker/Carbohydrate antigen15 3 ELISA Kit

Sign In for Pricing
View Details
Human Mammary carcinoma Marker/Carbohydrate antigen15 3 ELISA Kit
MBS723359-02 48 Strip Well (Sandwich)

Human Mammary carcinoma Marker/Carbohydrate antigen15 3 ELISA Kit

Sign In for Pricing
View Details
Human Mammary carcinoma Marker/Carbohydrate antigen15 3 ELISA Kit
MBS723359-03 96 Strip Well (Competitive)

Human Mammary carcinoma Marker/Carbohydrate antigen15 3 ELISA Kit

Sign In for Pricing
View Details