Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Peptide - N-terminal region

DPY19L3 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZPD9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPY19L3 Rabbit Polyclonal Antibody (orb586984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997208

Preservative

Lyophilized powder

AA Sequence

QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMAD9 shRNA (UAS) - Lentiviral human SMAD9 shRNA (UAS, iRFP) plasmid
GTR15158464 1 Vial

Lentiviral human SMAD9 shRNA (UAS) - Lentiviral human SMAD9 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Zelandopam hydrochloride
T35298 25 mg

Zelandopam hydrochloride

Sign In for Pricing
View Details
DGCR6 Human Pre-designed siRNA Set A
HY-RS03713 1 Set

DGCR6 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Sephs1 (NM_175400) Mouse Recombinant Protein
E45M46718M5 20 µg

Sephs1 (NM_175400) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Twist-2 Antibody (OTI6H10) [CoraFluor 1]
NBP2-74724CL1 0.1 mL

Mouse Monoclonal Twist-2 Antibody (OTI6H10) [CoraFluor 1]

Sign In for Pricing
View Details
Kdelr2 (NM_025841) Mouse Tagged Lenti ORF Clone
MR202320L3 10 µg

Kdelr2 (NM_025841) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details