Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Peptide - N-terminal region

DPY19L3 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZPD9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPY19L3 Rabbit Polyclonal Antibody (orb586984) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997208

Preservative

Lyophilized powder

AA Sequence

QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Transforming growth factor β1 (TGF-β1) ELISA Kit
AE17204RB-01 48 Tests

Rabbit Transforming growth factor β1 (TGF-β1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Transforming growth factor β1 (TGF-β1) ELISA Kit
AE17204RB-02 96 Tests

Rabbit Transforming growth factor β1 (TGF-β1) ELISA Kit

Sign In for Pricing
View Details
Human glial fibrillary acidic protein, GFAP ELISA Kit
MBS704044-01 24 Well (LIMIT 1)

Human glial fibrillary acidic protein, GFAP ELISA Kit

Sign In for Pricing
View Details
Human glial fibrillary acidic protein, GFAP ELISA Kit
MBS704044-02 48 Well

Human glial fibrillary acidic protein, GFAP ELISA Kit

Sign In for Pricing
View Details
Human glial fibrillary acidic protein, GFAP ELISA Kit
MBS704044-03 96 Well

Human glial fibrillary acidic protein, GFAP ELISA Kit

Sign In for Pricing
View Details
Human glial fibrillary acidic protein, GFAP ELISA Kit
MBS704044-04 5x 96 Well

Human glial fibrillary acidic protein, GFAP ELISA Kit

Sign In for Pricing
View Details