Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RACK1 Peptide - C-terminal region

RACK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P205, Gnb2l1, GB-like, AL033335, Gnb2-rs1

UniProt

P68040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RACK1 Rabbit Polyclonal Antibody (orb584983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032169

Preservative

Lyophilized powder

AA Sequence

HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matr3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
28151116 3x 1.0 µg

Matr3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
mmu-miR-1893 miRNA Agomir
MBS8313888-01 5 nmol

mmu-miR-1893 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-1893 miRNA Agomir
MBS8313888-02 10 nmol

mmu-miR-1893 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-1893 miRNA Agomir
MBS8313888-03 20 nmol

mmu-miR-1893 miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-1893 miRNA Agomir
MBS8313888-04 5x 20 nmol

mmu-miR-1893 miRNA Agomir

Sign In for Pricing
View Details
MYPT1, phosphorylated (Thr696) discontinued
539381-01 30ul

MYPT1, phosphorylated (Thr696) discontinued

Sign In for Pricing
View Details