Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RACK1 Peptide - C-terminal region

RACK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P205, Gnb2l1, GB-like, AL033335, Gnb2-rs1

UniProt

P68040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RACK1 Rabbit Polyclonal Antibody (orb584983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032169

Preservative

Lyophilized powder

AA Sequence

HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC19 Polyclonal Antibody
MBS2560252-01 0.02 mL

LRRC19 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC19 Polyclonal Antibody
MBS2560252-02 0.06 mL

LRRC19 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC19 Polyclonal Antibody
MBS2560252-03 0.12 mL

LRRC19 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC19 Polyclonal Antibody
MBS2560252-04 0.2 mL

LRRC19 Polyclonal Antibody

Sign In for Pricing
View Details
LRRC19 Polyclonal Antibody
MBS2560252-05 5x 0.2 mL

LRRC19 Polyclonal Antibody

Sign In for Pricing
View Details
FASTK Adenovirus (Human)
20257053 1.0 mL

FASTK Adenovirus (Human)

Sign In for Pricing
View Details