Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wsb1 Peptide - middle region

Wsb1 Peptide - middle region

Product Specifications

UniProt

B3DM89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wsb1 Rabbit Polyclonal Antibody (orb326407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036026

Preservative

Lyophilized powder

AA Sequence

VPWSQCLKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPREHIIDCGDIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody
CAU23761-01 100 µL

Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody

Sign In for Pricing
View Details
Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody
CAU23761-02 200 µL

Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody

Sign In for Pricing
View Details
Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody
CAU23761-03 1 mL

Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody

Sign In for Pricing
View Details
4-phenyl-5- (2-phenylquinolin-4-yl) -4H-1,2,4-triazole-3-thiol
sc-277629 1 g

4-phenyl-5- (2-phenylquinolin-4-yl) -4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
Human Corticoliberin (CRH) Protein (OVA)
abx656957-01 100 µg

Human Corticoliberin (CRH) Protein (OVA)

Sign In for Pricing
View Details
Human Corticoliberin (CRH) Protein (OVA)
abx656957-02 200 µg

Human Corticoliberin (CRH) Protein (OVA)

Sign In for Pricing
View Details