Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wsb1 Peptide - middle region

Wsb1 Peptide - middle region

Product Specifications

UniProt

B3DM89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wsb1 Rabbit Polyclonal Antibody (orb326407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036026

Preservative

Lyophilized powder

AA Sequence

VPWSQCLKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPREHIIDCGDIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-mmu-miR-494-5p Vector
mm41427 500 ng

LentimiRa-mmu-miR-494-5p Vector

Sign In for Pricing
View Details
DCUN1D4 Protein Vector (Mouse) (pPB-C-His)
PV170970 500 ng

DCUN1D4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Guinea Pig Axin interactor, dorsalization associated protein (AIDA) ELISA Kit
GTR10333309 96 Well

Guinea Pig Axin interactor, dorsalization associated protein (AIDA) ELISA Kit

Sign In for Pricing
View Details
USP8P1 Protein Vector (Human) (pPM-C-HA)
49344021 500 ng

USP8P1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Crcp sgRNA CRISPR Lentivector (Rat) (Target 2)
K7070503 1.0 µg DNA

Crcp sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Chicken Cytochrome c oxidase ELISA kit
GTR10415154 96 Well

Chicken Cytochrome c oxidase ELISA kit

Sign In for Pricing
View Details