Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wsb1 Peptide - middle region

Wsb1 Peptide - middle region

Product Specifications

UniProt

B3DM89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wsb1 Rabbit Polyclonal Antibody (orb326407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036026

Preservative

Lyophilized powder

AA Sequence

VPWSQCLKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPREHIIDCGDIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN4CL (NM_203422) Human Over-expression Lysate
LS221091-100ug 100 µg

LRRN4CL (NM_203422) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Heart Right Ventricle Tissue Lysate
30R-AH068 150 ug

Human Heart Right Ventricle Tissue Lysate

Sign In for Pricing
View Details
PECMV-3xFLAG-CD4
BZ11713 1 Vial

PECMV-3xFLAG-CD4

Sign In for Pricing
View Details
UBE2E3 Rabbit Polyclonal Antibody (Cy3)
orb990639 100 µL

UBE2E3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Olfr620 Protein Vector (Mouse) (pPM-C-HA)
33310024 500 ng

Olfr620 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4) ELISA Kit
MBS285600-01 48 Tests

Human Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4) ELISA Kit

Sign In for Pricing
View Details