ARMH1 Peptide - middle region
ARMH1 Peptide - middle region
Product Specifications
Product Name Alternative
P40, C1orf228, NCRNA00082
UniProt
Q6PIY5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARMH1 Rabbit Polyclonal Antibody (orb587286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001139108
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIAEFLAKSKSEETQEEVQVLLDSLVHGNPKYQNQVYKGLIALLPCESPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH2258D265A-5mg 5 mg
Mouse IgG1 (IB5) Isotype Control D265A for In Vivo
Sign In for Pricing
View Details 
