Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sostdc1 Peptide - C-terminal region

Sostdc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0610006G05Rik, Sostl, USAG-1, Wise, ectodin

UniProt

Q9CQN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_079588

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AzoDye-1 Maleimide
2404-AAT 1 mg

AzoDye-1 Maleimide

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP06096PU-N 100 µg

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Corilagin
TRC-C695400-5MG 5 mg

Corilagin

Sign In for Pricing
View Details
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody
AP01435PU-N 100 µg

AVPR V2 (AVPR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human HMGB1 Protein
PKSH032544-01 10 µg

Recombinant Human HMGB1 Protein

Sign In for Pricing
View Details
Recombinant Human HMGB1 Protein
PKSH032544-02 50 µg

Recombinant Human HMGB1 Protein

Sign In for Pricing
View Details