Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sostdc1 Peptide - C-terminal region

Sostdc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0610006G05Rik, Sostl, USAG-1, Wise, ectodin

UniProt

Q9CQN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_079588

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RQCD1 (CNOT9) Human Gene Knockout Kit (CRISPR)
KN216067RB 1 Kit

RQCD1 (CNOT9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZHX2 Mouse Monoclonal Antibody [Clone ID: OTI2E11]
CF810637 100 µg

ZHX2 Mouse Monoclonal Antibody [Clone ID: OTI2E11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: transverse
CS626043 5x 5 µm

Frozen Tissue Sections, Colon: transverse

Sign In for Pricing
View Details
CIAP1 Recombinant Rabbit monoclonal Antibody
HA723283B 100 µL

CIAP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Alpaca IgG (H+L), AlpHcAbs® Goat antibody (HRP) plus
HA710027 200 µg

Alpaca IgG (H+L), AlpHcAbs® Goat antibody (HRP) plus

Sign In for Pricing
View Details
Glutathione S Transferase theta 1 (GSTT1) Human Gene Knockout Kit (CRISPR)
KN402807 1 Kit

Glutathione S Transferase theta 1 (GSTT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details