Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC34 Peptide - middle region

CCDC34 Peptide - middle region

Product Specifications

Product Name Alternative

NY-REN-41, RAMA3

UniProt

Q96HJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC34 Rabbit Polyclonal Antibody (orb587179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542385

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteinase 3 Antibody (PR3Ab) Human ELISA Kit
G4631 96 Tests

Proteinase 3 Antibody (PR3Ab) Human ELISA Kit

Sign In for Pricing
View Details
ENG Antibody, Biotin conjugated
CSB-PA007667LD01HU-01 50 μL

ENG Antibody, Biotin conjugated

Sign In for Pricing
View Details
ENG Antibody, Biotin conjugated
CSB-PA007667LD01HU-02 100 µL

ENG Antibody, Biotin conjugated

Sign In for Pricing
View Details
RIPK2 Antibody
E19-6967 100 µg -100 µL

RIPK2 Antibody

Sign In for Pricing
View Details
CXXC5 Antibody, FITC conjugated
CSB-PA741975LC01HU-01 50 µg

CXXC5 Antibody, FITC conjugated

Sign In for Pricing
View Details
CXXC5 Antibody, FITC conjugated
CSB-PA741975LC01HU-02 100 µg

CXXC5 Antibody, FITC conjugated

Sign In for Pricing
View Details