Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC34 Peptide - middle region

CCDC34 Peptide - middle region

Product Specifications

Product Name Alternative

NY-REN-41, RAMA3

UniProt

Q96HJ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC34 Rabbit Polyclonal Antibody (orb587179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542385

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NNQEEQKQVRLPESRLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Hexylpyridinium triflate
IL-0181-HP-0250 250 g

1-Hexylpyridinium triflate

Sign In for Pricing
View Details
MBP Recombinant Protein Antigen
NBP2-33555PEP 0.1 mL

MBP Recombinant Protein Antigen

Sign In for Pricing
View Details
1700040L02Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10232094 4x 500 ng

1700040L02Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
SEC14 Antibody
orb849887 2 mg

SEC14 Antibody

Sign In for Pricing
View Details
Krt10 siRNA Oligos set (Mouse)
25925174 3x 5 nmol

Krt10 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
ECEL1 (NM_004826) Human Over-expression Lysate
LC417714 20 µg

ECEL1 (NM_004826) Human Over-expression Lysate

Sign In for Pricing
View Details