MZT1 Peptide - middle region
MZT1 Peptide - middle region
Product Specifications
Product Name Alternative
C13orf37, MOZART1
UniProt
Q08AG7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MZT1 Rabbit Polyclonal Antibody (orb587555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001065243
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MP0301X Each
Magic™ Membrane Protein Human SLC10A7 (Solute carrier family 10 member 7) for Antibody Discovery
Sign In for Pricing
View Details 
orb2407534 100 µL
Carbonic anhydrase 3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details 
11104210 25 Pieces
Non-sterile Regenerated Cellulose Vent Filter (injection molding), 0.45 (μm), 50 (mm), 25pcs/pk
Sign In for Pricing
View Details