Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MZT1 Peptide - middle region

MZT1 Peptide - middle region

Product Specifications

Product Name Alternative

C13orf37, MOZART1

UniProt

Q08AG7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MZT1 Rabbit Polyclonal Antibody (orb587555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001065243

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKM2 Antibody
MBS9611019-01 0.05 mL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
MBS9611019-02 0.1 mL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
MBS9611019-03 0.2 mL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
MBS9611019-04 5x 0.2 mL

PKM2 Antibody

Sign In for Pricing
View Details
Malic enzyme inhibitor ME1
MBS3843028-01 1 mg

Malic enzyme inhibitor ME1

Sign In for Pricing
View Details
Malic enzyme inhibitor ME1
MBS3843028-02 5 mg

Malic enzyme inhibitor ME1

Sign In for Pricing
View Details