GIPR Peptide - N-terminal region
GIPR Peptide - N-terminal region
Product Specifications
UniProt
B7WP14
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GIPR Rabbit Polyclonal Antibody (orb331254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1801-500 1x 500 µL
ETS1 (Marker of Tumor Metastasis) (ETS1/1801), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![MTF1 Mouse Monoclonal Antibody [Clone ID: OTI7D6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907d35/imageurl/cf805483.webp)
HA725039H 100 µL
Mouse/Rat IGF1 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 