Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIPR Peptide - N-terminal region

GIPR Peptide - N-terminal region

Product Specifications

UniProt

B7WP14

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIPR Rabbit Polyclonal Antibody (orb331254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VMAT2 (SLC18A2) (C-term) Goat Polyclonal Antibody
AP16297PU-N 100 µg

VMAT2 (SLC18A2) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Slc25a53 Mouse Gene Knockout Kit (CRISPR)
KN515999 1 Kit

Slc25a53 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BTBD3 Mouse Monoclonal Antibody [Clone ID: OTI1A10]
CF808660 100 µg

BTBD3 Mouse Monoclonal Antibody [Clone ID: OTI1A10]

Sign In for Pricing
View Details
Flometoquin
TRC-F118830-50MG 50 mg

Flometoquin

Sign In for Pricing
View Details
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA367570 100 µL

G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Giardia lamblia (BB1.1E5), Biotin conjugate, 0.1mg/mL
BNCB0210-100 1x 100 µL

Giardia lamblia (BB1.1E5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details