Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAL Peptide - C-terminal region

ADAL Peptide - C-terminal region

Product Specifications

UniProt

Q6DHV7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAL Rabbit Polyclonal Antibody (orb581462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKSQTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1LC3B2 (NM_001085481) Human Over-expression Lysate
LC421324 20 µg

MAP1LC3B2 (NM_001085481) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504155 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human MMP13 Recombinant Rabbit monoclonal Antibody
HA723294 100 µL

Human MMP13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TRP1 (TYRP1) (NM_000550) Human Recombinant Protein
TP308595M 100 µg

TRP1 (TYRP1) (NM_000550) Human Recombinant Protein

Sign In for Pricing
View Details
2-Hydroxy-9-(4-hydroxyphenyl)-1H-phenalen-1-one
TRC-H673630-750MG 750 mg

2-Hydroxy-9-(4-hydroxyphenyl)-1H-phenalen-1-one

Sign In for Pricing
View Details
KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G9]
TA505429AM 100 µL

KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G9]

Sign In for Pricing
View Details