Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAL Peptide - C-terminal region

ADAL Peptide - C-terminal region

Product Specifications

UniProt

Q6DHV7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAL Rabbit Polyclonal Antibody (orb581462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKSQTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17A Antibody (Biotin)
KB-3000-01 50 μL

IL17A Antibody (Biotin)

Sign In for Pricing
View Details
IL17A Antibody (Biotin)
KB-3000-02 100 µL

IL17A Antibody (Biotin)

Sign In for Pricing
View Details
IL17A Antibody (Biotin)
KB-3000-03 1 mL

IL17A Antibody (Biotin)

Sign In for Pricing
View Details
Rabeprazole Sulfide
TRC-R070510-25MG 25 mg

Rabeprazole Sulfide

Sign In for Pricing
View Details
Recombinant Human SNU13 Protein (His Tag)
PKSH032810-01 10 µg

Recombinant Human SNU13 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SNU13 Protein (His Tag)
PKSH032810-02 50 µg

Recombinant Human SNU13 Protein (His Tag)

Sign In for Pricing
View Details