Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Peptide - C-terminal region

UBQLN4 Peptide - C-terminal region

Product Specifications

UniProt

D3DVA8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBQLN4 Rabbit Polyclonal Antibody (orb583536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMSRTPAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVI2A siRNA (Human)
orb1866781-01 15 nmol

EVI2A siRNA (Human)

Sign In for Pricing
View Details
EVI2A siRNA (Human)
orb1866781-02 30 nmol

EVI2A siRNA (Human)

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G3]
TA505953BM 100 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G3]

Sign In for Pricing
View Details
Fancg (NM_001163233) Mouse Tagged ORF Clone
MR219937 10 µg

Fancg (NM_001163233) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Arbidol
MBS6101730-01 10 mg

Arbidol

Sign In for Pricing
View Details
Arbidol
MBS6101730-02 5x 10 mg

Arbidol

Sign In for Pricing
View Details